PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.M01679.2.p
Common NameMIMGU_mgv1a003822mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 555aa    MW: 60533.7 Da    PI: 7.4727
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.M01679.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.87.2e-31203260260
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                       +DgynWrKYGqK vkgsefprsYY+Ct+++C+vkk  ers   ++++ei+Y+g+H+h+k
  Migut.M01679.2.p 203 EDGYNWRKYGQKLVKGSEFPRSYYKCTYPNCEVKKIFERSP-SGQITEIVYKGSHDHPK 260
                       7****************************************.9**************85 PP

2WRKY105.33.2e-33371429159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+v+g+++prsYY+Ct  gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Migut.M01679.2.p 371 LDDGYRWRKYGQKVVRGNPNPRSYYKCTNVGCPVRKHVERASHDPKAVITTYEGKHNHD 429
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-26189261IPR003657WRKY domain
SuperFamilySSF1182901.96E-24195261IPR003657WRKY domain
PROSITE profilePS5081122.619197261IPR003657WRKY domain
SMARTSM007741.3E-32202260IPR003657WRKY domain
PfamPF031061.8E-23203259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.5E-37356431IPR003657WRKY domain
SuperFamilySSF1182902.75E-29363431IPR003657WRKY domain
PROSITE profilePS5081138.549366431IPR003657WRKY domain
SMARTSM007745.3E-39371430IPR003657WRKY domain
PfamPF031068.9E-26372429IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MEDAHSSYSH YQHHSPPSSN NADAVGSING AKYRLMSPAK LPISRSTSIT IPPGLSPTSF  60
LDSPVLLSNI KAEPSPTTGS FFKPHLMQGS GENAALSLEK FFSGRKAVDE KTSSSFEFRF  120
QTGASSTSGL SSAGLSGPVV YQDQHNSQPP VPSQSVVVGA HNSPIRNSID ELNQGGQSNT  180
GNRTSSSEHK DSISTVSNER TSEDGYNWRK YGQKLVKGSE FPRSYYKCTY PNCEVKKIFE  240
RSPSGQITEI VYKGSHDHPK PQPARRQNSG ALLSIQEDKP DKDLLFTGQE DKLNNNKMEQ  300
NASPMLSPLQ TNEDNVDVSV SQYPGLNDDV EEDDPFLKRR KMEEGIDATP VVKPIREPRV  360
VVQTLSEVDI LDDGYRWRKY GQKVVRGNPN PRSYYKCTNV GCPVRKHVER ASHDPKAVIT  420
TYEGKHNHDV PTAKNNNNNN NNNNNNNISS HDFSAQYAGA NSKLRPPQDS SSGNGSISLD  480
LGVGIGREAM DAEEGRGQIG NPASAAAQIP AYYGIVNMYG NRDNLVEGRS SFQAPPMHPS  540
NQCPPSLGRI LMGP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A5e-37193431877Probable WRKY transcription factor 4
1wj2_A5e-37193431877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012848780.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
TrEMBLA0A022QFE30.0A0A022QFE3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000766700.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.21e-148WRKY family protein